원본
Thermo Fisher Scientific ACAA2 Polyclonal Antibody
상품 한눈에 보기
ACAA2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB, IHC, ICC, Flow Cytometry 등에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, Lyophilized 형태로 제공되어 높은 안정성과 재현성을 제공합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오후 08:29
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA578709 ACAA2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific ACAA2 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10^6 cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human ACAA2 (207–242aa: EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745825 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ACAA2 (3-Ketoacyl-CoA thiolase)는 인간에서 ACAA2 유전자에 의해 발현되는 효소로, mitochondrial fatty acid β-oxidation의 마지막 단계를 촉매합니다. 대부분의 mitochondrial matrix 단백질과 달리, non-cleavable amino-terminal targeting signal을 포함합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-78709_ACAA2_P42765-1_Rabbit.svg, PA5-78709_ACAA2_P42765-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific ACE Polyclonal Antibody565,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ACADVL Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ABL2 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ABI1 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.