Thermo Fisher Scientific ACAA2 Polyclonal Antibody
ACAA2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB, IHC, ICC, Flow Cytometry 등에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, Lyophilized 형태로 제공되어 높은 안정성과 재현성을 제공합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10^6 cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human ACAA2 (207–242aa: EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745825 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ACAA2 (3-Ketoacyl-CoA thiolase)는 인간에서 ACAA2 유전자에 의해 발현되는 효소로, mitochondrial fatty acid β-oxidation의 마지막 단계를 촉매합니다. 대부분의 mitochondrial matrix 단백질과 달리, non-cleavable amino-terminal targeting signal을 포함합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-78709_ACAA2_P42765-1_Rabbit.svg, PA5-78709_ACAA2_P42765-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ACE Polyclonal Antibody
565,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ACADVL Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ACAA2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ABL2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ABI1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|