Thermo Fisher Scientific Nanog Polyclonal Antibody, PeproTech

Applications and Tested Dilutions

Product Specifications

Product Specific Information

AA Sequence of recombinant protein:
SVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKV...PEDV.

Preparation:
Produced from sera of rabbits immunized with highly pure Recombinant Human Nanog. Anti-Human Nanog-specific antibody was purified by affinity chromatography employing an immobilized Human Nanog matrix.

Sandwich ELISA:
To detect Human Nanog by sandwich ELISA (100 µL/well antibody solution), use 0.5–2.0 µg/mL of this antibody. In conjunction with PeproTech Biotinylated Anti-Human Nanog (500-P236Bt) as a detection antibody, it allows detection of at least 0.2–0.4 ng/well of Recombinant Human Nanog.

Western Blot:
For detection of Human Nanog by Western Blot, use 0.1–0.2 µg/mL. With compatible secondary reagents, the detection limit for Recombinant Human Nanog is 1.5–3.0 ng/lane under either reducing or non-reducing conditions.

Target Information

NANOG (Nanog homeobox) is a divergent homeodomain protein that directs pluripotency and differentiation in undifferentiated embryonic stem cells. NANOG mRNA is expressed in pluripotent mouse and human cell lines but absent from differentiated cells.

• Human NANOG shares 52% overall amino acid identity with mouse NANOG and 85% identity in the homeodomain.
• Human NANOG maps to gene locus 12p13.31; mouse NANOG maps to 6 F2.
• It regulates proliferation and self-renewal of inner cell mass and embryonic stem (ES) cells.
• Overexpression promotes entry into S phase and proliferation.
• Dysfunction is associated with teratocarcinoma and germ cell/embryonal cancer.

NANOG is also used in studies of induced pluripotent stem (iPS) cell generation, where expression of NANOG with Sox2, Klf4, Lin28, and c-Myc enables reprogramming of somatic cells without viral vectors, offering potential for regenerative medicine.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.