Thermo Fisher Scientific Nanog Polyclonal Antibody, PeproTech

Thermo Fisher Scientific Nanog Polyclonal Antibody, PeproTech

상품 한눈에 보기

Rabbit polyclonal antibody recognizing human Nanog protein. Validated for WB, IHC, ICC, and ELISA. Suitable for detection of Nanog in pluripotent stem cell research. Supplied lyophilized, purified by antigen affinity chromatography, and stored at -20°C.

상품 옵션 정보

다양한 옵션의 상품 정보와 가격을 확인하세요

마지막 업데이트
2025. 08. 05. 오전 12:50
장비
500-P236-1MG
Thermo Fisher Scientific 500-P236-1MG Nanog Polyclonal Antibody, PeproTech 1 mg pk
CAS: -단위: pk
재고문의재고: -
3,448,900
(VAT포함)3,793,790
소모품
500-P236-100UG
Thermo Fisher Scientific 500-P236-100UG Nanog Polyclonal Antibody, PeproTech 100 ug pk
CAS: -단위: pk
재고문의재고: -
411,600
(VAT포함)452,760
500-P236-50UG
Thermo Fisher Scientific 500-P236-50UG Nanog Polyclonal Antibody, PeproTech 50 ug pk
CAS: -단위: pk
재고문의재고: -
328,500
(VAT포함)361,350
장비
500-P236-1MG
재고문의재고: -
Thermo Fisher Scientific 500-P236-1MG Nanog Polyclonal Antibody, PeproTech 1 mg pk
CAS: -단위: pk
3,448,900
(VAT포함)3,793,790
소모품
500-P236-100UG
재고문의재고: -
Thermo Fisher Scientific 500-P236-100UG Nanog Polyclonal Antibody, PeproTech 100 ug pk
CAS: -단위: pk
411,600
(VAT포함)452,760
500-P236-50UG
재고문의재고: -
Thermo Fisher Scientific 500-P236-50UG Nanog Polyclonal Antibody, PeproTech 50 ug pk
CAS: -단위: pk
328,500
(VAT포함)361,350

AI 추천 연관 상품

AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요

연관 상품을 찾고 있습니다...

Applications and Tested Dilutions

Application Tested Dilution Publications
Western Blot (WB) 0.1–0.2 µg/mL 7 publications
Immunohistochemistry (IHC) 4 publications
Immunocytochemistry (ICC/IF) 14 publications
ELISA 0.5–2.0 µg/mL
In vitro Assay (IV) 2 publications
Immunostaining (IS) 7 publications

Product Specifications

Specification Description
Species Reactivity Human
Published Species Amphibian, Bovine, Dog, Human, Mouse, Pig
Host / Isotype Rabbit
Class Polyclonal
Type Antibody
Immunogen E.coli-derived Recombinant Human Nanog
Conjugate Unconjugated
Form Lyophilized
Concentration 0.1–1.0 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS
Contains No preservative
Storage Conditions -20°C
Shipping Conditions Ambient
RRID AB_2929966

Product Specific Information

AA Sequence of recombinant protein:
SVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKV...PEDV.

Preparation:
Produced from sera of rabbits immunized with highly pure Recombinant Human Nanog. Anti-Human Nanog-specific antibody was purified by affinity chromatography employing an immobilized Human Nanog matrix.

Sandwich ELISA:
To detect Human Nanog by sandwich ELISA (100 µL/well antibody solution), use 0.5–2.0 µg/mL of this antibody. In conjunction with PeproTech Biotinylated Anti-Human Nanog (500-P236Bt) as a detection antibody, it allows detection of at least 0.2–0.4 ng/well of Recombinant Human Nanog.

Western Blot:
For detection of Human Nanog by Western Blot, use 0.1–0.2 µg/mL. With compatible secondary reagents, the detection limit for Recombinant Human Nanog is 1.5–3.0 ng/lane under either reducing or non-reducing conditions.


Target Information

NANOG (Nanog homeobox) is a divergent homeodomain protein that directs pluripotency and differentiation in undifferentiated embryonic stem cells. NANOG mRNA is expressed in pluripotent mouse and human cell lines but absent from differentiated cells.

  • Human NANOG shares 52% overall amino acid identity with mouse NANOG and 85% identity in the homeodomain.
  • Human NANOG maps to gene locus 12p13.31; mouse NANOG maps to 6 F2.
  • It regulates proliferation and self-renewal of inner cell mass and embryonic stem (ES) cells.
  • Overexpression promotes entry into S phase and proliferation.
  • Dysfunction is associated with teratocarcinoma and germ cell/embryonal cancer.

NANOG is also used in studies of induced pluripotent stem (iPS) cell generation, where expression of NANOG with Sox2, Klf4, Lin28, and c-Myc enables reprogramming of somatic cells without viral vectors, offering potential for regenerative medicine.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.


배송/결제/교환/반품 안내

배송 정보

기본 배송비
  • - 배송비 3,850원 (부가세 포함)
  • - 10만원 이상 구매시 배송비 무료
  • - 도서산간 및 제주를 포함한 일부 지역 추가비용 발생
  • - 장비의 경우 추가 배송비 및 설치비가 청구 될 수 있습니다
교환/반품 배송비
  • - 상품 별로 상이
착불 배송비
  • - 착불 적용 상품에 개별 부과 (상품 별로 상이)
교환/반품 배송비
  • - 상품 별로 상이

결제 및 환불 안내

결제수단
  • - 신용카드
  • - 가상계좌
  • - 연구비카드
  • - 세금계산서 (기업은행 033-502993-01-019)
  • - 세금계산서 (신한은행 100-032-703829)
  • - 상품 결제 후 최대 60일 이내 제공 완료
취소
  • - 취소 접수 후 3 ~ 5일 이내 환불 처리
반품
  • - 반품 접수 후 3 ~ 5일 이내 환불 처리
환급
  • - 회사는 회원이 구매신청한 상품 등이 품절 등의 사유로 인도 또는 제공할 수 없을 때에는 지체 없이 그 사유를 회원에게 통지하고,
      사전에 상품 등의 대금을 받은 경우에는 대금을 받은 날로부터 3영업일 이내에 환급하거나 환급에 필요한 조치를 취합니다.

교환 및 반품 접수

교환 및 반품 접수 기한
  • - 상품 수령일로부터 7일 이내
교환 및 반품 접수가 가능한 경우
  • - 제품의 하자는 없지만, 다른 상품으로 교환하거나 반품 원하는 경우
     (배송비 고객 부담)
  • - 상품자체 불량 및 하자에 의한 경우
  • - 상품 오배송에 의한 경우
교환 및 반품 접수가 불가능한 경우
  • - 상품 수령 후 7일을 초과한 경우
  • - 개별 포장 상품의 포장을 훼손한 경우
  • - 고객의 고의적인 귀책으로 상품가치가 훼손된 경우
  • - 주문제작을 통해서 제품을 생산하는 경우
  • - 주문 당시 재고가 없어서 해외를 통해 제품을 수입해서 구매하는 경우

교환 및 반품 신청

교환 절차
  • - 상품 불량/오배송/상품파손
  • - 전화(02-585-1342) 또는 info@cacheby.com에 상품교환 접수
반품 절차
  • - 반품할 품목을 확인 후 info@cacheby.com로 반품 신청 (수령 후 7일 이내 가능하며 이후 불가)
  • - 전달드린 주문번호와 함께 반품 상품을 포장
     (포장을 꼼꼼하게 해주셔야 반품 상품 손상에 따른 불이익이 없습니다.)
  • - 택배회사 방문 시 반품 상품 전달
     (택배사의 반송장은 상품 교환이 완료될 때까지 보관해주시기 바랍니다.)
  • - 회수된 제품 확인 후 하자없을시 배송비를 제외하고 환불 처리 진행
     (환불 처리 후 입금까지 최대 2주까지 소요될 수 있습니다.)

문의 0