Thermo Fisher Scientific Nanog Polyclonal Antibody, PeproTech
Rabbit polyclonal antibody recognizing human Nanog protein. Validated for WB, IHC, ICC, and ELISA. Suitable for detection of Nanog in pluripotent stem cell research. Supplied lyophilized, purified by antigen affinity chromatography, and stored at -20°C.
- 판매단위
- pk
카탈로그
3개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Nanog Polyclonal Antibody, PeproTech
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.2 µg/mL | 7 publications |
| Immunohistochemistry (IHC) | – | 4 publications |
| Immunocytochemistry (ICC/IF) | – | 14 publications |
| ELISA | 0.5–2.0 µg/mL | – |
| In vitro Assay (IV) | – | 2 publications |
| Immunostaining (IS) | – | 7 publications |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Published Species | Amphibian, Bovine, Dog, Human, Mouse, Pig |
| Host / Isotype | Rabbit |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | E.coli-derived Recombinant Human Nanog |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.1–1.0 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient |
| RRID | AB_2929966 |
Product Specific Information
AA Sequence of recombinant protein:
SVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKV...PEDV.
Preparation:
Produced from sera of rabbits immunized with highly pure Recombinant Human Nanog. Anti-Human Nanog-specific antibody was purified by affinity chromatography employing an immobilized Human Nanog matrix.
Sandwich ELISA:
To detect Human Nanog by sandwich ELISA (100 µL/well antibody solution), use 0.5–2.0 µg/mL of this antibody. In conjunction with PeproTech Biotinylated Anti-Human Nanog (500-P236Bt) as a detection antibody, it allows detection of at least 0.2–0.4 ng/well of Recombinant Human Nanog.
Western Blot:
For detection of Human Nanog by Western Blot, use 0.1–0.2 µg/mL. With compatible secondary reagents, the detection limit for Recombinant Human Nanog is 1.5–3.0 ng/lane under either reducing or non-reducing conditions.
Target Information
NANOG (Nanog homeobox) is a divergent homeodomain protein that directs pluripotency and differentiation in undifferentiated embryonic stem cells. NANOG mRNA is expressed in pluripotent mouse and human cell lines but absent from differentiated cells.
- Human NANOG shares 52% overall amino acid identity with mouse NANOG and 85% identity in the homeodomain.
- Human NANOG maps to gene locus 12p13.31; mouse NANOG maps to 6 F2.
- It regulates proliferation and self-renewal of inner cell mass and embryonic stem (ES) cells.
- Overexpression promotes entry into S phase and proliferation.
- Dysfunction is associated with teratocarcinoma and germ cell/embryonal cancer.
NANOG is also used in studies of induced pluripotent stem (iPS) cell generation, where expression of NANOG with Sox2, Klf4, Lin28, and c-Myc enables reprogramming of somatic cells without viral vectors, offering potential for regenerative medicine.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.