Thermo Fisher Scientific Nanog Polyclonal Antibody, Biotin, PeproTech

Thermo Fisher Scientific Nanog Polyclonal Antibody, Biotin, PeproTech

상품 한눈에 보기

인간 Nanog 단백질을 인식하는 비오틴 표지 폴리클로날 항체로, Western blot 및 ELISA에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 고순도 재조합 Nanog로 면역화된 토끼 혈청에서 생산되었습니다. 줄기세포 연구 및 Nanog 발현 분석에 유용합니다.

상품 옵션 정보

다양한 옵션의 상품 정보와 가격을 확인하세요

마지막 업데이트
2025. 08. 05. 오전 12:50
장비
500-P236BT-500UG
Thermo Fisher Scientific 500-P236BT-500UG Nanog Polyclonal Antibody, Biotin, PeproTech 500 ug pk
CAS: -단위: pk
재고문의재고: -
3,831,800
(VAT포함)4,214,980
장비
500-P236BT-500UG
재고문의재고: -
Thermo Fisher Scientific 500-P236BT-500UG Nanog Polyclonal Antibody, Biotin, PeproTech 500 ug pk
CAS: -단위: pk
3,831,800
(VAT포함)4,214,980

AI 추천 연관 상품

AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요

연관 상품을 찾고 있습니다...

Thermo Fisher Scientific Nanog Polyclonal Antibody, Biotin, PeproTech

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.2 µg/mL
ELISA 0.25–1.0 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host/Isotype Rabbit
Class Polyclonal
Type Antibody
Immunogen E.coli-derived, 34.5 kDa Recombinant Human Nanog
Conjugate Biotin
Form Lyophilized
Concentration 0.1–1.0 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS
Contains No preservative
Storage Conditions -20°C
Shipping Conditions Ambient

Product Specific Information

  • AA Sequence of recombinant protein:
    SVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQS WNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV.

  • Preparation:
    Produced from sera of rabbits immunized with highly pure Recombinant Human Nanog. Anti-Human Nanog-specific antibody was purified by affinity chromatography and biotinylated.

  • Sandwich ELISA:
    To detect hNanog by sandwich ELISA (100 µL/well antibody solution), use 0.25–1.0 µg/mL of this antibody. When used with PeproTech Polyclonal Anti-Human Nanog (500-P236) as a capture antibody, detection of at least 0.2–0.4 ng/well of Recombinant hNanog is possible.

  • Western Blot:
    For hNanog detection, use 0.1–0.2 µg/mL antibody. Detection limit for Recombinant hNanog is 1.5–3.0 ng/lane under reducing or non-reducing conditions.

  • Package Information:
    500-P236BT-1MG is supplied as 2 × 500 µg.

Target Information

NANOG (Nanog homeobox) is a divergent homeodomain protein that regulates pluripotency and differentiation of embryonic stem cells. NANOG mRNA is found in pluripotent mouse and human cell lines and absent in differentiated cells. Human NANOG shares 52% overall amino acid identity with the mouse protein and 85% identity in the homeodomain.
Human NANOG maps to gene locus 12p13.31, while mouse NANOG maps to 6 F2.
High NANOG expression is observed in undifferentiated N-Tera embryonal carcinoma cells. NANOG acts as a transcription regulator involved in proliferation and self-renewal of embryonic stem cells.

It plays a key role in the generation of induced pluripotent stem (iPS) cells, which can be created by expressing transcription factors such as POU5F1 (Oct-4), Sox2, Klf4, Lin28, and c-Myc. Experiments have shown that iPS cells can be generated using expression plasmids for NANOG, Sox2, Klf4, and c-Myc, avoiding viral introduction and improving safety for regenerative medicine applications.
Overexpression of NANOG promotes entry into S phase and cell proliferation.
Diseases associated with NANOG dysfunction include tetracarcinoma and germ cell/embryonal cancer.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)


배송/결제/교환/반품 안내

배송 정보

기본 배송비
  • - 배송비 3,850원 (부가세 포함)
  • - 10만원 이상 구매시 배송비 무료
  • - 도서산간 및 제주를 포함한 일부 지역 추가비용 발생
  • - 장비의 경우 추가 배송비 및 설치비가 청구 될 수 있습니다
교환/반품 배송비
  • - 상품 별로 상이
착불 배송비
  • - 착불 적용 상품에 개별 부과 (상품 별로 상이)
교환/반품 배송비
  • - 상품 별로 상이

결제 및 환불 안내

결제수단
  • - 신용카드
  • - 가상계좌
  • - 연구비카드
  • - 세금계산서 (기업은행 033-502993-01-019)
  • - 세금계산서 (신한은행 100-032-703829)
  • - 상품 결제 후 최대 60일 이내 제공 완료
취소
  • - 취소 접수 후 3 ~ 5일 이내 환불 처리
반품
  • - 반품 접수 후 3 ~ 5일 이내 환불 처리
환급
  • - 회사는 회원이 구매신청한 상품 등이 품절 등의 사유로 인도 또는 제공할 수 없을 때에는 지체 없이 그 사유를 회원에게 통지하고,
      사전에 상품 등의 대금을 받은 경우에는 대금을 받은 날로부터 3영업일 이내에 환급하거나 환급에 필요한 조치를 취합니다.

교환 및 반품 접수

교환 및 반품 접수 기한
  • - 상품 수령일로부터 7일 이내
교환 및 반품 접수가 가능한 경우
  • - 제품의 하자는 없지만, 다른 상품으로 교환하거나 반품 원하는 경우
     (배송비 고객 부담)
  • - 상품자체 불량 및 하자에 의한 경우
  • - 상품 오배송에 의한 경우
교환 및 반품 접수가 불가능한 경우
  • - 상품 수령 후 7일을 초과한 경우
  • - 개별 포장 상품의 포장을 훼손한 경우
  • - 고객의 고의적인 귀책으로 상품가치가 훼손된 경우
  • - 주문제작을 통해서 제품을 생산하는 경우
  • - 주문 당시 재고가 없어서 해외를 통해 제품을 수입해서 구매하는 경우

교환 및 반품 신청

교환 절차
  • - 상품 불량/오배송/상품파손
  • - 전화(02-585-1342) 또는 info@cacheby.com에 상품교환 접수
반품 절차
  • - 반품할 품목을 확인 후 info@cacheby.com로 반품 신청 (수령 후 7일 이내 가능하며 이후 불가)
  • - 전달드린 주문번호와 함께 반품 상품을 포장
     (포장을 꼼꼼하게 해주셔야 반품 상품 손상에 따른 불이익이 없습니다.)
  • - 택배회사 방문 시 반품 상품 전달
     (택배사의 반송장은 상품 교환이 완료될 때까지 보관해주시기 바랍니다.)
  • - 회수된 제품 확인 후 하자없을시 배송비를 제외하고 환불 처리 진행
     (환불 처리 후 입금까지 최대 2주까지 소요될 수 있습니다.)

문의 0