Thermo Fisher Scientific Nanog Polyclonal Antibody, Biotin, PeproTech

Thermo Fisher Scientific Nanog Polyclonal Antibody, Biotin, PeproTech

Applications and Tested Dilution

Product Specifications

Product Specific Information

• AA Sequence of recombinant protein:
  SVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQS WNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV.

• Preparation:
  Produced from sera of rabbits immunized with highly pure Recombinant Human Nanog. Anti-Human Nanog-specific antibody was purified by affinity chromatography and biotinylated.

• Sandwich ELISA:
  To detect hNanog by sandwich ELISA (100 µL/well antibody solution), use 0.25–1.0 µg/mL of this antibody. When used with PeproTech Polyclonal Anti-Human Nanog (500-P236) as a capture antibody, detection of at least 0.2–0.4 ng/well of Recombinant hNanog is possible.

• Western Blot:
  For hNanog detection, use 0.1–0.2 µg/mL antibody. Detection limit for Recombinant hNanog is 1.5–3.0 ng/lane under reducing or non-reducing conditions.

• Package Information:
  500-P236BT-1MG is supplied as 2 × 500 µg.

Target Information

NANOG (Nanog homeobox) is a divergent homeodomain protein that regulates pluripotency and differentiation of embryonic stem cells. NANOG mRNA is found in pluripotent mouse and human cell lines and absent in differentiated cells. Human NANOG shares 52% overall amino acid identity with the mouse protein and 85% identity in the homeodomain.
Human NANOG maps to gene locus 12p13.31, while mouse NANOG maps to 6 F2.
High NANOG expression is observed in undifferentiated N-Tera embryonal carcinoma cells. NANOG acts as a transcription regulator involved in proliferation and self-renewal of embryonic stem cells.

It plays a key role in the generation of induced pluripotent stem (iPS) cells, which can be created by expressing transcription factors such as POU5F1 (Oct-4), Sox2, Klf4, Lin28, and c-Myc. Experiments have shown that iPS cells can be generated using expression plasmids for NANOG, Sox2, Klf4, and c-Myc, avoiding viral introduction and improving safety for regenerative medicine applications.
Overexpression of NANOG promotes entry into S phase and cell proliferation.
Diseases associated with NANOG dysfunction include tetracarcinoma and germ cell/embryonal cancer.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)