Thermo Fisher Scientific IFNGR1 (CD119) Polyclonal Antibody
인간 IFNGR1(CD119)을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 유세포분석(Flow Cytometry)에 적합합니다. 합성 펩타이드 면역원 기반으로 제작되었으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
- 카탈로그번호
- PA579443
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific IFNGR1 (CD119) Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human IFNGR1 (108–147aa, QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746559 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The IFNGR1 gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. The human interferon-gamma receptor is a heterodimer composed of IFNGR1 and IFNGR2. Genetic variations in IFNGR1 are associated with susceptibility to Helicobacter pylori infection. Defects in IFNGR1 can cause Mendelian susceptibility to mycobacterial disease (familial disseminated atypical mycobacterial infection).
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.