Thermo Fisher Scientific IFNGR1 (CD119) Polyclonal Antibody
인간 IFNGR1(CD119)을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 유세포분석(Flow Cytometry)에 적합합니다. 합성 펩타이드 면역원 기반으로 제작되었으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human IFNGR1 (108–147aa, QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746559 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The IFNGR1 gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. The human interferon-gamma receptor is a heterodimer composed of IFNGR1 and IFNGR2. Genetic variations in IFNGR1 are associated with susceptibility to Helicobacter pylori infection. Defects in IFNGR1 can cause Mendelian susceptibility to mycobacterial disease (familial disseminated atypical mycobacterial infection).
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific IGFBP-1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IGF1R (CD221) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IFNGR1 (CD119) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IGFBP-1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IGF1R (CD221) Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|