Thermo Fisher Scientific IGFBP-1 Polyclonal Antibody
Thermo Fisher Scientific IGFBP-1 Polyclonal Antibody는 마우스 및 랫트 시료에 반응하는 항체로, Western blot 및 ELISA에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 연구용으로 IGFBP-1 단백질 분석에 활용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific IGFBP-1 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
ELISA
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP-1 (177–207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746564 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain.
The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma.
Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.
For Research Use Only. Not for use in diagnostic procedures.
Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.