Thermo Fisher Scientific IGFBP-1 Polyclonal Antibody
Thermo Fisher Scientific IGFBP-1 Polyclonal Antibody는 마우스 및 랫트 시료에 반응하는 항체로, Western blot 및 ELISA에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 연구용으로 IGFBP-1 단백질 분석에 활용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
ELISA
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP-1 (177–207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746564 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain.
The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma.
Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.
For Research Use Only. Not for use in diagnostic procedures.
Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific IGFBP2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IGFBP-1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IGFBP-1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IGF1R (CD221) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IFNGR1 (CD119) Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|