
Thermo Fisher Scientific Relaxin 1 Polyclonal Antibody
Human 및 Rat에서 반응하는 Relaxin 1 폴리클로날 항체로, Western blot 및 IHC(P) 분석에 적합. 합성 펩타이드 면역원으로 제작되었으며, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도 유지. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human Relaxin 1 (VAAKWKDDVIKLCGRELVRAQIAICGMSTWS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2747041 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Relaxins are known endocrine and autocrine/paracrine hormones belonging to the insulin gene superfamily. In humans, three non-allelic relaxin genes exist: RLN1, RLN2, and RLN3.
RLN1 and RLN2 share high sequence homology. The encoded protein is synthesized as a single-chain polypeptide, but the active form consists of an A chain and a B chain linked by disulfide bonds. Relaxin is produced by the ovary and affects the reproductive system by ripening the cervix, elongating the pubic symphysis, and inhibiting uterine contraction.
Additional roles may include enhancing sperm motility, regulating blood pressure, controlling heart rate, and releasing oxytocin and vasopressin.
This gene has multiple polyadenylation sites and alternatively spliced transcript variants whose full-length nature is not yet known.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific RBP4 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific RBP4 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Relaxin 1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific p130 Polyclonal Antibody
544,000원

Thermo Fisher Scientific
Thermo Fisher Scientific RNF2 Polyclonal Antibody
514,100원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|