Thermo Fisher Scientific Relaxin 1 Polyclonal Antibody
Human 및 Rat에서 반응하는 Relaxin 1 폴리클로날 항체로, Western blot 및 IHC(P) 분석에 적합. 합성 펩타이드 면역원으로 제작되었으며, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도 유지. 연구용으로만 사용 가능.
- 카탈로그번호
- PA579926
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Relaxin 1 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human Relaxin 1 (VAAKWKDDVIKLCGRELVRAQIAICGMSTWS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2747041 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Relaxins are known endocrine and autocrine/paracrine hormones belonging to the insulin gene superfamily. In humans, three non-allelic relaxin genes exist: RLN1, RLN2, and RLN3.
RLN1 and RLN2 share high sequence homology. The encoded protein is synthesized as a single-chain polypeptide, but the active form consists of an A chain and a B chain linked by disulfide bonds. Relaxin is produced by the ovary and affects the reproductive system by ripening the cervix, elongating the pubic symphysis, and inhibiting uterine contraction.
Additional roles may include enhancing sperm motility, regulating blood pressure, controlling heart rate, and releasing oxytocin and vasopressin.
This gene has multiple polyadenylation sites and alternatively spliced transcript variants whose full-length nature is not yet known.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.