
원본
Thermo Fisher Scientific RAB13 Polyclonal Antibody
상품 한눈에 보기
RAB13 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot, ICC/IF, Flow Cytometry에 적합합니다. 합성 펩타이드를 면역원으로 사용하였으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 06:06
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579902 RAB13 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific RAB13 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.25–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human RAB13 (121–150aa NKCDMEAKRKVQKEQADKLAREHGIRFFET) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747017 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
RAB13 participates in polarized transport and in the assembly and/or activity of tight junctions.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
