원본
Thermo Fisher Scientific RAB13 Polyclonal Antibody
상품 한눈에 보기
RAB13 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot, ICC/IF, Flow Cytometry에 적합합니다. 합성 펩타이드를 면역원으로 사용하였으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
- 카탈로그번호
- PA579902
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 06:06
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579902 RAB13 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific RAB13 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.25–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human RAB13 (121–150aa NKCDMEAKRKVQKEQADKLAREHGIRFFET) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747017 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
RAB13 participates in polarized transport and in the assembly and/or activity of tight junctions.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific RAB14 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific RAB27A Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific RAB10 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PYY Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.