
Thermo Fisher Scientific RAB13 Polyclonal Antibody
상품 한눈에 보기
RAB13 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot, ICC/IF, Flow Cytometry에 적합합니다. 합성 펩타이드를 면역원으로 사용하였으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.25–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human RAB13 (121–150aa NKCDMEAKRKVQKEQADKLAREHGIRFFET) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747017 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
RAB13 participates in polarized transport and in the assembly and/or activity of tight junctions.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific RAB14 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific RAB27A Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific RAB13 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific RAB10 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PYY Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.