CacheBy
Atlas Antibodies Anti-POLR2J Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-POLR2J Antibody

상품 한눈에 보기

인간 POLR2J 단백질을 인식하는 폴리클로날 항체입니다. Rabbit IgG로 제작되었으며, IHC 등 다양한 응용에 적합합니다. PrEST 항원으로 특이적 정제되어 높은 선택성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042997-100 Anti-POLR2J Antibody, polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042997-25 Anti-POLR2J Antibody, polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-POLR2J Antibody

Anti-POLR2J Antibody

Target Protein: polymerase (RNA) II (DNA directed) polypeptide J, 13.3 kDa
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal antibody against Human POLR2J


Alternative Gene Names

hRPB14, POLR2J1, RPB11, RPB11A, RPB11m

Open Datasheet


Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Sequence:
    VGWTLARVPRPGTALACFFGGPQGEAAVMEEQGLPPQAPGHVD

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000025314 37%
Rat ENSRNOG00000056955 33%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.