
Atlas Antibodies Anti-POLR2J Antibody
상품 한눈에 보기
인간 POLR2J 단백질을 인식하는 폴리클로날 항체입니다. Rabbit IgG로 제작되었으며, IHC 등 다양한 응용에 적합합니다. PrEST 항원으로 특이적 정제되어 높은 선택성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-POLR2J Antibody
Target Protein: polymerase (RNA) II (DNA directed) polypeptide J, 13.3 kDa
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against Human POLR2J
Alternative Gene Names
hRPB14, POLR2J1, RPB11, RPB11A, RPB11m
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Sequence:
VGWTLARVPRPGTALACFFGGPQGEAAVMEEQGLPPQAPGHVD
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000025314 | 37% |
| Rat | ENSRNOG00000056955 | 33% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-POLR2J Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2J Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2J Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2I Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2H Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.