
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-POLR2J Antibody
상품 한눈에 보기
인간 POLR2J 단백질을 인식하는 폴리클로날 항체입니다. Rabbit IgG로 제작되었으며, IHC 등 다양한 응용에 적합합니다. PrEST 항원으로 특이적 정제되어 높은 선택성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042997-100 Anti-POLR2J Antibody, polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042997-25 Anti-POLR2J Antibody, polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-POLR2J Antibody
Anti-POLR2J Antibody
Target Protein: polymerase (RNA) II (DNA directed) polypeptide J, 13.3 kDa
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against Human POLR2J
Alternative Gene Names
hRPB14, POLR2J1, RPB11, RPB11A, RPB11m
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Sequence:
VGWTLARVPRPGTALACFFGGPQGEAAVMEEQGLPPQAPGHVD
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000025314 | 37% |
| Rat | ENSRNOG00000056955 | 33% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



