Atlas Antibodies Anti-POLR2H Antibody

상품 한눈에 보기

Rabbit polyclonal antibody against human POLR2H for IHC and WB applications. Orthogonal and independent validation confirm specificity. Affinity purified using PrEST antigen, suitable for human, mouse, and rat samples.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA055813-100 Anti-POLR2H Antibody, polymerase (RNA) II (DNA directed) polypeptide H 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA055813-25 Anti-POLR2H Antibody, polymerase (RNA) II (DNA directed) polypeptide H 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-POLR2H Antibody

Anti-POLR2H Antibody

polymerase (RNA) II (DNA directed) polypeptide H

Recommended Applications

IHC Orthogonal Validation: Comparison to RNA-seq data in high and low expression tissues confirms protein expression specificity.
WB Independent Validation: Validation by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human POLR2H

Alternative Gene Names

RPB8

Target Information

항목	내용
Target Protein	polymerase (RNA) II (DNA directed) polypeptide H
Target Gene	POLR2H
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEY
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Mouse ENSMUSG00000021018 (100%), Rat ENSRNOG00000049116 (100%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand