
Atlas Antibodies Anti-POLR2H Antibody
상품 한눈에 보기
Rabbit polyclonal antibody against human POLR2H for IHC and WB applications. Orthogonal and independent validation confirm specificity. Affinity purified using PrEST antigen, suitable for human, mouse, and rat samples.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-POLR2H Antibody
polymerase (RNA) II (DNA directed) polypeptide H
Recommended Applications
- IHC Orthogonal Validation: Comparison to RNA-seq data in high and low expression tissues confirms protein expression specificity.
- WB Independent Validation: Validation by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human POLR2H
Alternative Gene Names
RPB8
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | polymerase (RNA) II (DNA directed) polypeptide H |
| Target Gene | POLR2H |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEY |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000021018 (100%), Rat ENSRNOG00000049116 (100%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-POLR2J Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2I Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2I Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2F Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.