Atlas Antibodies Anti-POLR2J Antibody
상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA044010-100 | - | Atlas Antibodies HPA044010-100 Anti-POLR2J Antibody, polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA044010-25 | - | Atlas Antibodies HPA044010-25 Anti-POLR2J Antibody, polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-POLR2J Antibody
polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa
Recommended Applications
Product Description
Polyclonal Antibody against Human POLR2J
Alternative Gene Names
hRPB14, POLR2J1, RPB11, RPB11A, RPB11m
Target Protein
polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa
Target Gene
POLR2J
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
VGWTLARVPRPGTALACFFGGPQGEAAVMEEQGLPPQAPGHVD
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000025314 (37%)
Rat ENSRNOG00000056955 (33%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|