CacheBy
Atlas Antibodies Anti-POLR2J Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-POLR2J Antibody

상품 한눈에 보기

인간 POLR2J 단백질을 인식하는 토끼 폴리클로날 항체로, RNA polymerase II의 13.3kDa 소단위체를 타겟으로 함. IHC 등 다양한 응용에 적합하며, 고순도 Affinity 정제 방식으로 제조됨. 40% 글리세롤 기반 PBS 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046970-100 Anti-POLR2J Antibody, polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046970-25 Anti-POLR2J Antibody, polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-POLR2J Antibody

Anti-POLR2J Antibody

Target: polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 연구용 응용에 적합함.


Product Description

Polyclonal Antibody against Human POLR2J


Alternative Gene Names

hRPB14, POLR2J1, RPB11, RPB11A, RPB11m

Open Datasheet


Target Information

항목 내용
Target Protein polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa
Target Gene POLR2J
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VGWTLARVPRPGTALACFFGGPQGEAAVMEEQGLPPQAPGHVD

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 유사도
Mouse ENSMUSG00000025314 37%
Rat ENSRNOG00000056955 33%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.