
Atlas Antibodies Anti-POLR2I Antibody
상품 한눈에 보기
Human POLR2I 단백질을 인식하는 토끼 다클론 항체로, RNA polymerase II의 소단위체를 타깃으로 함. 면역세포화학(ICC) 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human, Mouse, Rat에서 반응 확인됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-POLR2I Antibody
Target: polymerase (RNA) II (DNA directed) polypeptide I, 14.5 kDa
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학 (ICC)
Product Description
Polyclonal antibody against Human POLR2I.
Alternative Gene Names
hRPB14.5, RPB9
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | polymerase (RNA) II (DNA directed) polypeptide I, 14.5 kDa |
| Target Gene | POLR2I |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCT |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000019738 (100%), Rat ENSRNOG00000050560 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-POLR2I Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2I Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2F Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2H Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.