
Atlas Antibodies Anti-POLR2F Antibody
상품 한눈에 보기
인체 POLR2F 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB(재조합 발현), ICC에 적합. 토끼 유래 IgG 항체로 프레스티지 항원 친화 정제. 인간, 생쥐, 랫트 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-POLR2F Antibody
Target: polymerase (RNA) II (DNA directed) polypeptide F
Type: Polyclonal Antibody against Human POLR2F
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (Recombinant Expression)
- Immunocytochemistry (ICC)
Validation: Recombinant expression validation in WB using target protein overexpression.
Alternative Gene Names
HRBP14.4, RPB6
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | polymerase (RNA) II (DNA directed) polypeptide F |
| Target Gene | POLR2F |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000011214 (100%), Mouse ENSMUSG00000033020 (100%) |
Antigen Sequence
GDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELII
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-POLR2H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2I Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2F Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2G Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.