
Atlas Antibodies Anti-PLA2G6 Antibody
상품 한눈에 보기
Human PLA2G6 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 ICC 실험에 적합하며, 재조합 발현 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 반응하며 Rat, Mouse와 높은 서열 유사성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PLA2G6 Antibody
Target: phospholipase A2, group VI (cytosolic, calcium-independent)
Supplier: Atlas Antibodies
Recommended Applications
- WB (Recombinant Expression Validation): Target 단백질 과발현을 이용한 Western blot 검증
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human PLA2G6
Alternative Gene Names
iPLA2, iPLA2beta, NBIA2, PARK14, PNPLA9
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phospholipase A2, group VI (cytosolic, calcium-independent) |
| Target Gene | PLA2G6 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000012295 | 91% |
| Mouse | ENSMUSG00000042632 | 91% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PLAA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLA2R1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLA2G6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLA2G4F Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLA2G4C Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.