CacheBy
Atlas Antibodies Anti-PLAA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLAA Antibody

상품 한눈에 보기

Human PLAA 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG이며 PrEST 항원으로 정제되었습니다. 인간, 생쥐, 랫드 반응성이 검증되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020994-100 Anti-PLAA Antibody, phospholipase A2-activating protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020994-25 Anti-PLAA Antibody, phospholipase A2-activating protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLAA Antibody

Anti-PLAA Antibody

phospholipase A2-activating protein


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent Validation)
  • ICC (Immunocytochemistry)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human PLAA


Alternative Gene Names

DOA1, FLJ11281, FLJ12699, PLA2P, PLAP

Open Datasheet


Target Information

항목 내용
Target Protein phospholipase A2-activating protein
Target Gene PLAA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TGAGRYVPGSASMGTTMAGVDPFTGNSAYRSAASKTMNIYFPKKEAVTFDQANPTQILGKLKELNGTAPEEKKLTEDDLILLEKILSLIC
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000007753 (92%), Mouse ENSMUSG00000028577 (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.