
Atlas Antibodies Anti-PLAA Antibody
상품 한눈에 보기
Human PLAA 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG이며 PrEST 항원으로 정제되었습니다. 인간, 생쥐, 랫드 반응성이 검증되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PLAA Antibody
phospholipase A2-activating protein
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Independent Validation)
- ICC (Immunocytochemistry)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PLAA
Alternative Gene Names
DOA1, FLJ11281, FLJ12699, PLA2P, PLAP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phospholipase A2-activating protein |
| Target Gene | PLAA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TGAGRYVPGSASMGTTMAGVDPFTGNSAYRSAASKTMNIYFPKKEAVTFDQANPTQILGKLKELNGTAPEEKKLTEDDLILLEKILSLIC |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000007753 (92%), Mouse ENSMUSG00000028577 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PLAC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLA2G4E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLAA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLA2R1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLA2G6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.