
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PLAA Antibody
상품 한눈에 보기
Human PLAA 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG이며 PrEST 항원으로 정제되었습니다. 인간, 생쥐, 랫드 반응성이 검증되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA020994-100 Anti-PLAA Antibody, phospholipase A2-activating protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020994-25 Anti-PLAA Antibody, phospholipase A2-activating protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PLAA Antibody
Anti-PLAA Antibody
phospholipase A2-activating protein
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Independent Validation)
- ICC (Immunocytochemistry)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PLAA
Alternative Gene Names
DOA1, FLJ11281, FLJ12699, PLA2P, PLAP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phospholipase A2-activating protein |
| Target Gene | PLAA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TGAGRYVPGSASMGTTMAGVDPFTGNSAYRSAASKTMNIYFPKKEAVTFDQANPTQILGKLKELNGTAPEEKKLTEDDLILLEKILSLIC |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000007753 (92%), Mouse ENSMUSG00000028577 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



