Atlas Antibodies Anti-PLA2G4F Antibody

상품 한눈에 보기

인체 PLA2G4F 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 RNA-seq 데이터 비교를 통한 오쏘고날 검증 완료. 토끼 유래 IgG, PrEST 항원으로 친화 정제. 인체 반응성 검증 및 안정한 PBS/glycerol 버퍼 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056752-100 Anti-PLA2G4F Antibody, phospholipase A2, group IVF 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056752-25 Anti-PLA2G4F Antibody, phospholipase A2, group IVF 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: phospholipase A2, group IVF
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human PLA2G4F

PLA2G4F / Z

항목	내용
Target Protein	phospholipase A2, group IVF
Target Gene	PLA2G4F
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	LVNRTFRTHLAPGVERQTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFYRLVALSRYNVLNNVETLKCALQLALDRHQARERA
Verified Species Reactivity	Human
Interspecies Identity	Mouse (77%), Rat (42%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand