AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PLA2G4C Antibody
상품 한눈에 보기
Human PLA2G4C 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에 적합. Rabbit 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 사람에 대한 반응성이 검증되었으며, glycerol/PBS buffer에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043083-100 Anti-PLA2G4C Antibody, phospholipase A2, group IVC (cytosolic, calcium-independent) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043083-25 Anti-PLA2G4C Antibody, phospholipase A2, group IVC (cytosolic, calcium-independent) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PLA2G4C Antibody
Anti-PLA2G4C Antibody
Target: phospholipase A2, group IVC (cytosolic, calcium-independent)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human PLA2G4C
Alternative Gene Names
- cPLA2-gamma
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phospholipase A2, group IVC (cytosolic, calcium-independent) |
| Target Gene | PLA2G4C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 일치율 |
|---|---|---|
| Mouse | ENSMUSG00000033847 | 56% |
| Rat | ENSRNOG00000026764 | 53% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.