CacheBy
Atlas Antibodies Anti-PLA2G15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLA2G15 Antibody

상품 한눈에 보기

인간 PLA2G15 단백질을 인식하는 폴리클로날 항체. IHC 등 단백질 발현 검증에 적합. 토끼에서 생산된 IgG 형태로, PrEST 항원을 이용해 친화 정제됨. 인간에 반응하며 쥐와 생쥐와도 높은 상동성 보유. PBS와 글리세롤 기반 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041702-100 Anti-PLA2G15 Antibody, phospholipase A2, group XV 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041702-25 Anti-PLA2G15 Antibody, phospholipase A2, group XV 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLA2G15 Antibody

Anti-PLA2G15 Antibody

Target: phospholipase A2, group XV

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human PLA2G15.

Alternative Gene Names

GXVPLA2, LLPL, LYPLA3

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein phospholipase A2, group XV
Target Gene PLA2G15
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFED
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000019859 (92%), Mouse ENSMUSG00000031903 (91%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.