AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PLA2G15 Antibody
상품 한눈에 보기
인간 PLA2G15 단백질을 인식하는 폴리클로날 항체. IHC 등 단백질 발현 검증에 적합. 토끼에서 생산된 IgG 형태로, PrEST 항원을 이용해 친화 정제됨. 인간에 반응하며 쥐와 생쥐와도 높은 상동성 보유. PBS와 글리세롤 기반 완충액에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041702-100 Anti-PLA2G15 Antibody, phospholipase A2, group XV 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041702-25 Anti-PLA2G15 Antibody, phospholipase A2, group XV 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PLA2G15 Antibody
Anti-PLA2G15 Antibody
Target: phospholipase A2, group XV
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human PLA2G15.
Alternative Gene Names
GXVPLA2, LLPL, LYPLA3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phospholipase A2, group XV |
| Target Gene | PLA2G15 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFED |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000019859 (92%), Mouse ENSMUSG00000031903 (91%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.