
Atlas Antibodies Anti-PLA2G15 Antibody
상품 한눈에 보기
인간 PLA2G15 단백질을 인식하는 폴리클로날 항체. IHC 등 단백질 발현 검증에 적합. 토끼에서 생산된 IgG 형태로, PrEST 항원을 이용해 친화 정제됨. 인간에 반응하며 쥐와 생쥐와도 높은 상동성 보유. PBS와 글리세롤 기반 완충액에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PLA2G15 Antibody
Target: phospholipase A2, group XV
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human PLA2G15.
Alternative Gene Names
GXVPLA2, LLPL, LYPLA3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phospholipase A2, group XV |
| Target Gene | PLA2G15 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFED |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000019859 (92%), Mouse ENSMUSG00000031903 (91%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PLA2G1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLA2G2E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLA2G15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLA2G12B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLA2G10 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.