CacheBy
Atlas Antibodies Anti-PLA2G10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLA2G10 Antibody

상품 한눈에 보기

Human PLA2G10 단백질을 타깃으로 하는 폴리클로날 토끼 항체. IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체로 인간 특이적 반응성 확인. 40% glycerol 기반 PBS buffer에 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041893-100 Anti-PLA2G10 Antibody, phospholipase A2, group X 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041893-25 Anti-PLA2G10 Antibody, phospholipase A2, group X 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLA2G10 Antibody

Anti-PLA2G10 Antibody

Target: phospholipase A2, group X
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against Human PLA2G10


Alternative Gene Names

  • GXPLA2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein phospholipase A2, group X
Target Gene PLA2G10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCH

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치율
Rat ENSRNOG00000003164 72%
Mouse ENSMUSG00000022683 72%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.