Atlas Antibodies Anti-PLA2G1B Antibody

상품 한눈에 보기

Human PLA2G1B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 포함한 단백질 발현 연구에 적합. RNA-seq 데이터 기반 정교한 Orthogonal 검증 수행. 고순도 Affinity 정제로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047822-100 Anti-PLA2G1B Antibody, phospholipase A2, group IB (pancreas) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047822-25 Anti-PLA2G1B Antibody, phospholipase A2, group IB (pancreas) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: phospholipase A2, group IB (pancreas)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human PLA2G1B.

PLA2, PLA2A, PPLA2

항목	내용
Target Protein	phospholipase A2, group IB (pancreas)
Target Gene	PLA2G1B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	DNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS

Human

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000029522	77%
Rat	ENSRNOG00000001153	74%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand