
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PLA2G2E Antibody
상품 한눈에 보기
Human PLA2G2E 단백질을 인식하는 rabbit polyclonal antibody로, IHC 등 다양한 연구용 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응 특이성을 가짐. 글리세롤 기반 완충액에 보존제를 포함함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA064085-100 Anti-PLA2G2E Antibody, phospholipase A2, group IIE 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064085-25 Anti-PLA2G2E Antibody, phospholipase A2, group IIE 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PLA2G2E Antibody
Anti-PLA2G2E Antibody
Target: phospholipase A2, group IIE (PLA2G2E)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human PLA2G2E.
Affinity purified using the PrEST antigen as affinity ligand.
Suitable for research use only.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phospholipase A2, group IIE |
| Target Gene | PLA2G2E |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GNLVQFGVMIEKMTGKSALQYNDYGCYCGIG |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (ENSMUSG00000028751, 90%), Rat (ENSRNOG00000016838, 56%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



