CacheBy
Atlas Antibodies Anti-PLA2G2E Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLA2G2E Antibody

상품 한눈에 보기

Human PLA2G2E 단백질을 인식하는 rabbit polyclonal antibody로, IHC 등 다양한 연구용 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응 특이성을 가짐. 글리세롤 기반 완충액에 보존제를 포함함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064085-100 Anti-PLA2G2E Antibody, phospholipase A2, group IIE 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064085-25 Anti-PLA2G2E Antibody, phospholipase A2, group IIE 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLA2G2E Antibody

Anti-PLA2G2E Antibody

Target: phospholipase A2, group IIE (PLA2G2E)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human PLA2G2E.
Affinity purified using the PrEST antigen as affinity ligand.
Suitable for research use only.

Open Datasheet


Target Information

항목 내용
Target Protein phospholipase A2, group IIE
Target Gene PLA2G2E
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GNLVQFGVMIEKMTGKSALQYNDYGCYCGIG
Verified Species Reactivity Human
Interspecies Identity Mouse (ENSMUSG00000028751, 90%), Rat (ENSRNOG00000016838, 56%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.