
Atlas Antibodies Anti-PFDN6 Antibody
상품 한눈에 보기
Human PFDN6 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 서열 동일성을 보여 인체, 랫, 마우스에서 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PFDN6 Antibody
Target: prefoldin subunit 6
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human PFDN6.
Alternative Gene Names
H2-KE2, HKE2, KE-2, PFD6
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | prefoldin subunit 6 |
| Target Gene | PFDN6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000000473 (100%), Mouse ENSMUSG00000024309 (100%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PFKFB4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PFKFB3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PFDN6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PFKFB3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PFKFB2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.