
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PFKFB4 Antibody
상품 한눈에 보기
Human PFKFB4 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제되었습니다. 면역형광 등 다양한 연구용 응용에 적합하며, 고순도의 IgG 형태로 제공됩니다.
- 카탈로그번호
- HPA047719-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA047719-100 Anti-PFKFB4 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047719-25 Anti-PFKFB4 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PFKFB4 Antibody
Anti-PFKFB4 Antibody
Target Information
- Target Protein: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
- Target Gene: PFKFB4
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI
Product Description
Polyclonal antibody against Human PFKFB4.
Recommended Applications
면역세포화학(ICC) 등 다양한 연구용 응용에 적합합니다.
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000025648): 97%
- Rat (ENSRNOG00000020656): 97%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



