CacheBy
Atlas Antibodies Anti-PFKFB4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PFKFB4 Antibody

상품 한눈에 보기

Human PFKFB4 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제되었습니다. 면역형광 등 다양한 연구용 응용에 적합하며, 고순도의 IgG 형태로 제공됩니다.

카탈로그번호
HPA047719-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047719-100 Anti-PFKFB4 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047719-25 Anti-PFKFB4 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PFKFB4 Antibody

Anti-PFKFB4 Antibody

Target Information

  • Target Protein: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
  • Target Gene: PFKFB4
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI

Product Description

Polyclonal antibody against Human PFKFB4.

Open Datasheet

면역세포화학(ICC) 등 다양한 연구용 응용에 적합합니다.

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000025648): 97%
  • Rat (ENSRNOG00000020656): 97%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.