CacheBy
Atlas Antibodies Anti-PFKFB3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PFKFB3 Antibody

상품 한눈에 보기

인간 PFKFB3 단백질을 타깃으로 하는 폴리클로날 항체. WB 및 ICC 등 다양한 응용에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증 완료. 친화성 정제 방식으로 높은 특이성과 재현성 제공.

카탈로그번호
HPA008266-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008266-100 Anti-PFKFB3 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008266-25 Anti-PFKFB3 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PFKFB3 Antibody

Anti-PFKFB3 Antibody

6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3

  • WB (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human PFKFB3

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
Target Gene PFKFB3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000026773 (97%), Rat ENSRNOG00000018911 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

Antigen Sequence

EEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQD

제품 이미지

Enhanced Validation
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.