CacheBy
Atlas Antibodies Anti-PFKFB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PFKFB2 Antibody

상품 한눈에 보기

인간 PFKFB2 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 ICC 실험에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 고순도의 IgG 형식으로 제공되며, 다양한 종 간 교차 반응성이 확인되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063575-100 Anti-PFKFB2 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063575-25 Anti-PFKFB2 Antibody, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PFKFB2 Antibody

Anti-PFKFB2 Antibody

6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PFKFB2.

Open Datasheet

Target Information

항목 내용
Target Protein 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
Target Gene PFKFB2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEG
Verified Species Reactivity Human
Interspecies Identity Mouse (95%), Rat (95%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.