원본

Atlas Antibodies Anti-C19orf71 Antibody

상품 한눈에 보기

Human C19orf71 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC, WB, ICC에 적합하며 PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, Rat 및 Mouse와의 상동성 정보가 제공됩니다.

카탈로그번호: HPA048654-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA048654-100 Anti-C19orf71 Antibody, chromosome 19 open reading frame 71 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA048654-25 Anti-C19orf71 Antibody, chromosome 19 open reading frame 71 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C19orf71 Antibody

Anti-C19orf71 Antibody

Target: chromosome 19 open reading frame 71
Type: Polyclonal Antibody against Human C19orf71

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against the human protein C19orf71 (chromosome 19 open reading frame 71).

Alternative Gene Names

LOC100128569

Target Information

항목	내용
Target Protein	chromosome 19 open reading frame 71
Target Gene	C19orf71
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	AWEAWYNLPRALASPFREAYNRWHSCYQHRECSMPSAYTQHLRETAWHDPIVPAQYQAPSTRWGSALWKDRPI

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000039861 (59%)
Mouse ENSMUSG00000020234 (55%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet