
Atlas Antibodies Anti-C19orf71 Antibody
상품 한눈에 보기
Human C19orf71 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC, WB, ICC에 적합하며 PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, Rat 및 Mouse와의 상동성 정보가 제공됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C19orf71 Antibody
Target: chromosome 19 open reading frame 71
Type: Polyclonal Antibody against Human C19orf71
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against the human protein C19orf71 (chromosome 19 open reading frame 71).
Alternative Gene Names
- LOC100128569
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 19 open reading frame 71 |
| Target Gene | C19orf71 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AWEAWYNLPRALASPFREAYNRWHSCYQHRECSMPSAYTQHLRETAWHDPIVPAQYQAPSTRWGSALWKDRPI |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000039861 (59%)
- Mouse ENSMUSG00000020234 (55%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C19orf68 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C19orf70 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C19orf71 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C19orf66 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C19orf60 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.