
원본
Atlas Antibodies Anti-C19orf71 Antibody
상품 한눈에 보기
Human C19orf71 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC, WB, ICC에 적합하며 PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, Rat 및 Mouse와의 상동성 정보가 제공됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA048654-100 Anti-C19orf71 Antibody, chromosome 19 open reading frame 71 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048654-25 Anti-C19orf71 Antibody, chromosome 19 open reading frame 71 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C19orf71 Antibody
Anti-C19orf71 Antibody
Target: chromosome 19 open reading frame 71
Type: Polyclonal Antibody against Human C19orf71
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against the human protein C19orf71 (chromosome 19 open reading frame 71).
Alternative Gene Names
- LOC100128569
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 19 open reading frame 71 |
| Target Gene | C19orf71 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AWEAWYNLPRALASPFREAYNRWHSCYQHRECSMPSAYTQHLRETAWHDPIVPAQYQAPSTRWGSALWKDRPI |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000039861 (59%)
- Mouse ENSMUSG00000020234 (55%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



