CacheBy
Atlas Antibodies Anti-C19orf66 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C19orf66 Antibody

상품 한눈에 보기

인간 C19orf66 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원 기반으로 정제되어 높은 특이성과 재현성을 제공. 인간에 대한 검증된 반응성과 정교한 정제 공정으로 신뢰성 높은 단백질 발현 분석에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA042001-100 Anti-C19orf66 Antibody, chromosome 19 open reading frame 66 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042001-25 Anti-C19orf66 Antibody, chromosome 19 open reading frame 66 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C19orf66 Antibody

Anti-C19orf66 Antibody

Target: chromosome 19 open reading frame 66
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Orthogonal validation using RNA-seq data comparison in high and low expression cell lines
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human C19orf66.


Alternative Gene Names

  • FLJ11286

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 19 open reading frame 66
Target Gene C19orf66
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000020580 (95%), Mouse ENSMUSG00000038884 (95%)

Antigen Sequence:

KFHGKASSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDD

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.