CacheBy
Atlas Antibodies Anti-C19orf60 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C19orf60 Antibody

상품 한눈에 보기

Human C19orf60 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 분석에 적합. Rabbit 유래 IgG 형식이며, PrEST 항원으로 친화 정제됨. 인간 반응성 검증 완료, 높은 특이성과 안정적 성능 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA043414-100 Anti-C19orf60 Antibody, chromosome 19 open reading frame 60 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043414-25 Anti-C19orf60 Antibody, chromosome 19 open reading frame 60 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C19orf60 Antibody

Anti-C19orf60 Antibody

Target: chromosome 19 open reading frame 60 (C19orf60)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C19orf60.


Alternative Gene Names

FLJ20850, FLJ30108, FLJ34606, FLJ37391

Open Datasheet (PDF)


Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    TVALLQLMETPELAGQEDAVRMQQLKMKVIKTMEAISEVLQDLRFDAESAE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000058833 69%
Rat ENSRNOG00000017692 29%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.