CacheBy
Atlas Antibodies Anti-C19orf68 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C19orf68 Antibody

상품 한눈에 보기

Human C19orf68 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합. PrEST 항원으로 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫트와 높은 서열 유사성 보유.

카탈로그번호
HPA061028-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061028-100 Anti-C19orf68 Antibody, chromosome 19 open reading frame 68 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061028-25 Anti-C19orf68 Antibody, chromosome 19 open reading frame 68 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C19orf68 Antibody

Anti-C19orf68 Antibody

Target: chromosome 19 open reading frame 68 (C19orf68)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C19orf68 protein.


Alternative Gene Names

  • LOC374920

Target Information

항목 내용
Target Protein chromosome 19 open reading frame 68
Target Gene C19orf68
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000070814 (90%), Rat ENSRNOG00000014186 (87%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RRLLSYCKGRDHGVLDALHVLEGLFRTDPEAKVKLVFVEDQAVVETVFFLTSRTRALLRRFPRMLLVDRL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


Datasheet

Open Datasheet (PDF)


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.