Atlas Antibodies Anti-C19orf57 Antibody

상품 한눈에 보기

Human C19orf57 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 기반 Orthogonal validation에 적합. Rabbit 유래 IgG 형식이며, PrEST 항원으로 친화 정제됨. 고품질 연구용으로 인간 시료에 최적화된 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054615-100 Anti-C19orf57 Antibody, chromosome 19 open reading frame 57 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054615-25 Anti-C19orf57 Antibody, chromosome 19 open reading frame 57 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: chromosome 19 open reading frame 57 (C19orf57)
Type: Polyclonal Antibody against Human C19orf57
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

항목	내용
Target Protein	chromosome 19 open reading frame 57
Target Gene	C19orf57
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000025796 (47%), Mouse ENSMUSG00000008129 (44%)

Antigen Sequence:
SQIQDALDASDFEAPPEQLFPSGNKPGPCWPGPSSHANGDPVAVAKAQPSRLIMGTHRDLEAFKRLNYRKTKLGGKAPLPYPSKGPGNIPRGDPPWREL

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand