
Atlas Antibodies Anti-C19orf57 Antibody
Human C19orf57 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 기반 Orthogonal validation에 적합. Rabbit 유래 IgG 형식이며, PrEST 항원으로 친화 정제됨. 고품질 연구용으로 인간 시료에 최적화된 항체.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C19orf57 Antibody
Target: chromosome 19 open reading frame 57 (C19orf57)
Type: Polyclonal Antibody against Human C19orf57
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Alternative Gene Names
- MGC11271
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 19 open reading frame 57 |
| Target Gene | C19orf57 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000025796 (47%), Mouse ENSMUSG00000008129 (44%) |
Antigen Sequence:
SQIQDALDASDFEAPPEQLFPSGNKPGPCWPGPSSHANGDPVAVAKAQPSRLIMGTHRDLEAFKRLNYRKTKLGGKAPLPYPSKGPGNIPRGDPPWREL
Product Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet
Open Datasheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C19orf66 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C19orf60 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C19orf57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C19orf53 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C19orf54 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|