CacheBy
Atlas Antibodies Anti-C19orf54 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C19orf54 Antibody

상품 한눈에 보기

인간 C19orf54 단백질을 인식하는 토끼 폴리클로날 항체. Western blot과 IHC에 적합. PrEST 항원으로 친화 정제됨. 인간에 특이적으로 반응하며, 랫드 및 마우스와 높은 서열 유사성 보유. 안정한 글리세롤/PBS 완충액에 보존.

카탈로그번호
HPA059628-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059628-100 Anti-C19orf54 Antibody, chromosome 19 open reading frame 54 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059628-25 Anti-C19orf54 Antibody, chromosome 19 open reading frame 54 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C19orf54 Antibody

Anti-C19orf54 Antibody

Target: chromosome 19 open reading frame 54 (C19orf54)
Type: Polyclonal Antibody against Human C19orf54


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human C19orf54 protein.
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • FLJ41131

Target Information

항목 내용
Target Protein chromosome 19 open reading frame 54
Target Gene C19orf54
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000037715 (79%), Mouse ENSMUSG00000078786 (77%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

CGLVALWMAGTLLSPPSGVPLERLIRVATERGYTAQGEMFSVADMGRLAQEVLGCQAKLLSGGLGGPNRDLVL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen

Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.