
Atlas Antibodies Anti-C16orf72 Antibody
상품 한눈에 보기
Human C16orf72 단백질을 표적으로 하는 폴리클로날 항체로, IHC와 WB 실험에 적합합니다. Rabbit에서 생산된 IgG 타입이며, PrEST 항원으로 친화 정제되었습니다. 높은 종간 서열 일치도와 안정적인 보존액 조성으로 재현성 높은 결과를 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C16orf72 Antibody
Target: chromosome 16 open reading frame 72 (C16orf72)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human C16orf72.
Alternative Gene Names
FLJ41272, PRO0149
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 16 open reading frame 72 |
| Target Gene | C16orf72 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000022507 (100%), Rat ENSRNOG00000002545 (100%) |
Antigen Sequence:
KLWHLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGYQRRNKDVLAWVKKRRRTIRREDLISFLC
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C16orf71 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf74 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf72 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf89 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf70 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.