CacheBy
Atlas Antibodies Anti-C16orf89 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C16orf89 Antibody

상품 한눈에 보기

Human C16orf89 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 독립적 검증 완료. 고순도 Affinity 정제 방식으로 제조. 다양한 종 간 상동성 정보 제공. 연구용으로 단백질 발현 분석에 적합.

카탈로그번호
HPA013613-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA013613-100 Anti-C16orf89 Antibody, chromosome 16 open reading frame 89 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013613-25 Anti-C16orf89 Antibody, chromosome 16 open reading frame 89 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C16orf89 Antibody

Anti-C16orf89 Antibody

Target: chromosome 16 open reading frame 89 (C16orf89)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human C16orf89


Alternative Gene Names

  • MGC45438

Target Information

항목 내용
Target Protein chromosome 16 open reading frame 89
Target Gene C16orf89
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000021796 (73%)
  • Mouse ENSMUSG00000051669 (70%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

구성 설명
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Information


제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.