
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C16orf89 Antibody
상품 한눈에 보기
Human C16orf89 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 독립적 검증 완료. 고순도 Affinity 정제 방식으로 제조. 다양한 종 간 상동성 정보 제공. 연구용으로 단백질 발현 분석에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA013613-100 Anti-C16orf89 Antibody, chromosome 16 open reading frame 89 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013613-25 Anti-C16orf89 Antibody, chromosome 16 open reading frame 89 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C16orf89 Antibody
Anti-C16orf89 Antibody
Target: chromosome 16 open reading frame 89 (C16orf89)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human C16orf89
Alternative Gene Names
- MGC45438
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 16 open reading frame 89 |
| Target Gene | C16orf89 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWA |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000021796 (73%)
- Mouse ENSMUSG00000051669 (70%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
| 구성 | 설명 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Information
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



