Atlas Antibodies Anti-C16orf71 Antibody

상품 한눈에 보기

사람 C16orf71 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. 정제된 PrEST 항원으로 특이성 향상. Rabbit 유래 IgG로, 인체 단백질 발현 검증에 활용 가능. 글리세롤 및 PBS 완충액에 보존 처리되어 안정적입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA049468-100 Anti-C16orf71 Antibody, chromosome 16 open reading frame 71 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA049468-25 Anti-C16orf71 Antibody, chromosome 16 open reading frame 71 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: chromosome 16 open reading frame 71 (C16orf71)
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
WB (Recombinant expression validation): Validation using target protein overexpression.

Polyclonal antibody against Human C16orf71.

DKFZp686H2240, FLJ43261

항목	내용
Target Protein	chromosome 16 open reading frame 71
Target Gene	C16orf71
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MASNDKGMAPSLGSPWASQMGPWDAILKAVKDQLPSLDSDSPLSDYGEEELFIFQRNQTSLIPDLSEELAEDPADG
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000028075 (63%), Mouse ENSMUSG00000042010 (29%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet