CacheBy
Atlas Antibodies Anti-C16orf70 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C16orf70 Antibody

상품 한눈에 보기

Human C16orf70 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합. 재조합 발현 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성 제공. 40% glycerol 기반의 안정한 버퍼에 보관.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA041214-100 Anti-C16orf70 Antibody, chromosome 16 open reading frame 70 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041214-25 Anti-C16orf70 Antibody, chromosome 16 open reading frame 70 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C16orf70 Antibody

Anti-C16orf70 Antibody

Target: chromosome 16 open reading frame 70 (C16orf70)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — validated by recombinant expression using target protein overexpression

Product Description

Polyclonal antibody against human C16orf70.


Alternative Gene Names

C16orf6, FLJ12076, lin-10, LIN10

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 16 open reading frame 70
Target Gene C16orf70
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HGATVKRMYIYSGNSLQDTKAPMMPLSCFLGNVYAESVDVLRDGTGPAGLRLRLLAAGCGPGLLADAKMRVFERSVYFGDSCQDVLSMLGSPHKVFYKS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat (ENSRNOG00000014668) – 97%
  • Mouse (ENSMUSG00000031889) – 96%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.