CacheBy
Atlas Antibodies Anti-C15orf39 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C15orf39 Antibody

상품 한눈에 보기

Human C15orf39 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간 반응성이 검증되었으며, 마우스와 랫트에도 높은 서열 유사성을 가짐.

카탈로그번호
HPA041907-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041907-100 Anti-C15orf39 Antibody, chromosome 15 open reading frame 39 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041907-25 Anti-C15orf39 Antibody, chromosome 15 open reading frame 39 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C15orf39 Antibody

Anti-C15orf39 Antibody

Target: chromosome 15 open reading frame 39 (C15orf39)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C15orf39.


Alternative Gene Names

  • DKFZP434H132
  • FLJ46337

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 15 open reading frame 39
Target Gene C15orf39
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LCDAISGSVAHSPPEKLREWLETAGPWGQAAWQDCQGVQGLLAKLLSQLQRFDRTHRCPFPHVVRAGAIFVPIHLVKERLFPRLPPASVDHVL
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000032300 (92%), Rat ENSRNOG00000018689 (88%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.