Atlas Antibodies Anti-C14orf39 Antibody
Human C14orf39 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. SIX6OS1 유전자 대체명으로도 알려짐. 휴먼에 반응하며 보존성이 높은 항원 서열 기반 제작.
- 카탈로그번호
- HPA059518-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-C14orf39 Antibody
Anti-C14orf39 Antibody
Target: chromosome 14 open reading frame 39 (C14orf39)
Alternative Gene Name: SIX6OS1
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human C14orf39, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
EVDEMEIEINYLNQQISRHNETKALSETLEEKNKNTENRKELKERIFGKDEHVLTLNKTQSSQLFLPYESQKLVRPIK
Species Reactivity
- Verified: Human
- Ortholog Identity:
- Mouse (ENSMUSG00000021098): 60%
- Rat (ENSRNOG00000031655): 56%
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
- Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Information
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.