
Atlas Antibodies Anti-C14orf39 Antibody
Human C14orf39 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. SIX6OS1 유전자 대체명으로도 알려짐. 휴먼에 반응하며 보존성이 높은 항원 서열 기반 제작.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C14orf39 Antibody
Target: chromosome 14 open reading frame 39 (C14orf39)
Alternative Gene Name: SIX6OS1
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human C14orf39, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
EVDEMEIEINYLNQQISRHNETKALSETLEEKNKNTENRKELKERIFGKDEHVLTLNKTQSSQLFLPYESQKLVRPIK
Species Reactivity
- Verified: Human
- Ortholog Identity:
- Mouse (ENSMUSG00000021098): 60%
- Rat (ENSRNOG00000031655): 56%
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
- Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Information
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C14orf80 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C15orf39 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf39 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf79 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf37 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|