Atlas Antibodies Anti-C14orf80 Antibody

상품 한눈에 보기

Human C14orf80 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합하며 PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며 보존된 서열을 기반으로 제작됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039049-100 Anti-C14orf80 Antibody, chromosome 14 open reading frame 80 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039049-25 Anti-C14orf80 Antibody, chromosome 14 open reading frame 80 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: chromosome 14 open reading frame 80 (C14orf80)
Supplier: Atlas Antibodies

Polyclonal antibody against Human C14orf80.
Affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):

RVLSPLPAGNALASLALEVQARLVKSALCSQGYPRLALAQLPEDGSQGSRELLLALSWLLARGPVPEQMLAQARVPLGDEMTV

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Storage	Store at recommended conditions; gently mix before use
Safety Information	Material Safety Data Sheet