CacheBy
Atlas Antibodies Anti-C14orf80 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C14orf80 Antibody

상품 한눈에 보기

Human C14orf80 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합하며 PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며 보존된 서열을 기반으로 제작됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039049-100 Anti-C14orf80 Antibody, chromosome 14 open reading frame 80 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039049-25 Anti-C14orf80 Antibody, chromosome 14 open reading frame 80 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C14orf80 Antibody

Anti-C14orf80 Antibody

Target: chromosome 14 open reading frame 80 (C14orf80)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human C14orf80.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):

RVLSPLPAGNALASLALEVQARLVKSALCSQGYPRLALAQLPEDGSQGSRELLLALSWLLARGPVPEQMLAQARVPLGDEMTV

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000037466 (67%)
  • Rat ENSRNOG00000005153 (65%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen
Storage Store at recommended conditions; gently mix before use
Safety Information Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.