CacheBy
Atlas Antibodies Anti-C14orf79 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C14orf79 Antibody

상품 한눈에 보기

Human C14orf79 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다. 인간에 대해 검증된 반응성을 가지며, 쥐 및 생쥐와의 교차 반응 가능성이 있습니다.

카탈로그번호
HPA042052-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042052-100 Anti-C14orf79 Antibody, chromosome 14 open reading frame 79 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042052-25 Anti-C14orf79 Antibody, chromosome 14 open reading frame 79 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C14orf79 Antibody

Anti-C14orf79 Antibody

Target: chromosome 14 open reading frame 79 (C14orf79)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C14orf79.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 14 open reading frame 79
Target Gene C14orf79
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GGPWVTGTSAVPPSEPILSYENILKCAFQEITVQQAAEDVSTIDHFLEISSEEKPGVERVHKLCNESRKL

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000013690 61%
Mouse ENSMUSG00000037594 60%

Buffer Composition


Storage & Handling

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.