
Atlas Antibodies Anti-C14orf79 Antibody
상품 한눈에 보기
Human C14orf79 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다. 인간에 대해 검증된 반응성을 가지며, 쥐 및 생쥐와의 교차 반응 가능성이 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C14orf79 Antibody
Target: chromosome 14 open reading frame 79 (C14orf79)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C14orf79.
Affinity purified using the PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 14 open reading frame 79 |
| Target Gene | C14orf79 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GGPWVTGTSAVPPSEPILSYENILKCAFQEITVQQAAEDVSTIDHFLEISSEEKPGVERVHKLCNESRKL |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000013690 | 61% |
| Mouse | ENSMUSG00000037594 | 60% |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Storage & Handling
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C15orf39 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf39 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf79 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf37 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf79 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.