CacheBy
Atlas Antibodies Anti-C14orf79 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C14orf79 Antibody

상품 한눈에 보기

인체 C14orf79 단백질에 대한 고특이성 폴리클로날 항체. 면역조직화학(IHC) 및 면역세포화학(ICC) 응용에 적합. 토끼 유래 IgG 항체로 PrEST 항원 친화 정제. 인간 반응성 검증 완료, 마우스 및 랫트 유사 서열 정보 제공.

카탈로그번호
HPA061117-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061117-100 Anti-C14orf79 Antibody, chromosome 14 open reading frame 79 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061117-25 Anti-C14orf79 Antibody, chromosome 14 open reading frame 79 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C14orf79 Antibody

Anti-C14orf79 Antibody

Target: chromosome 14 open reading frame 79 (C14orf79)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C14orf79.

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 14 open reading frame 79
Target Gene C14orf79
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000013690 (61%), Mouse ENSMUSG00000037594 (60%)

Antigen Sequence:
GGPWVTGTSAVPPSEPILSYENILKCAFQEITVQQAAEDVSTIDHFLEISSEEKPGVERVHKLCNESRKL


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.