AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C12orf75 Antibody
상품 한눈에 보기
Human C12orf75 단백질을 표적으로 하는 Rabbit Polyclonal 항체. IHC 및 ICC 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 대한 반응성이 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA065311-100 Anti-C12orf75 Antibody, chromosome 12 open reading frame 75 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065311-25 Anti-C12orf75 Antibody, chromosome 12 open reading frame 75 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C12orf75 Antibody
Anti-C12orf75 Antibody
Target: Chromosome 12 open reading frame 75 (C12orf75)
Type: Polyclonal Antibody against Human C12orf75
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Alternative Gene Names
AGD3, OCC-1, OCC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 12 open reading frame 75 |
| Target Gene | C12orf75 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRK |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000087651 | 85% |
| Rat | ENSRNOG00000060879 | 52% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.