Atlas Antibodies Anti-C12orf71 Antibody

상품 한눈에 보기

Human C12orf71 단백질을 인식하는 폴리클로날 항체로, 래빗에서 생산됨. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합. PBS/glycerol buffer에 보존되어 안정적이며, 인간에 대한 반응성이 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038359-100 Anti-C12orf71 Antibody, chromosome 12 open reading frame 71 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038359-25 Anti-C12orf71 Antibody, chromosome 12 open reading frame 71 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: chromosome 12 open reading frame 71 (C12orf71)

면역세포화학 (ICC)

Polyclonal antibody against human C12orf71.

Target Protein: chromosome 12 open reading frame 71
Target Gene: C12orf71
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
EDDSSKSNSNLSLSVGYFPCEDTPCEDTTSWEDAPSKGPSIHFLPPVQGAWGTERIGRRMKRQDQIQDEPEQFCKLSIFLAWDVDIGSDNTDSR

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.