AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C12orf65 Antibody
상품 한눈에 보기
Human C12orf65 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. WB 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 제품. 인체 반응성 검증 완료. 실험 조건에 따라 최적화 필요.
- 카탈로그번호
- HPA038194-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038194-100 Anti-C12orf65 Antibody, chromosome 12 open reading frame 65 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038194-25 Anti-C12orf65 Antibody, chromosome 12 open reading frame 65 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C12orf65 Antibody
Anti-C12orf65 Antibody
Target: chromosome 12 open reading frame 65
Supplier: Atlas Antibodies
Recommended Applications
Western Blot (WB)
Product Description
Polyclonal antibody against human C12orf65.
Alternative Gene Names
- FLJ38663
- SPG55
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 12 open reading frame 65 |
| Target Gene | C12orf65 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (71%), Rat (71%) |
Antigen Sequence:
GLFHFPTPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGPGGQATNKTSNC
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.