CacheBy
Atlas Antibodies Anti-C12orf76 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C12orf76 Antibody

상품 한눈에 보기

인간 C12orf76 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 재조합 발현 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039713-100 Anti-C12orf76 Antibody, chromosome 12 open reading frame 76 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039713-25 Anti-C12orf76 Antibody, chromosome 12 open reading frame 76 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C12orf76 Antibody

Anti-C12orf76 Antibody

Target: chromosome 12 open reading frame 76 (C12orf76)
Type: Polyclonal Antibody against Human C12orf76


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human C12orf76.
Validated for use in multiple applications including IHC, WB, and ICC.


Alternative Gene Names

  • FLJ40142

Target Information

항목 내용
Target Protein chromosome 12 open reading frame 76
Target Gene C12orf76
Antigen Sequence AELEEQSNHAGMGPILPAMPSVDGNHFQHPAGDCHPYGILCLQAHSASVTARQVLQ
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000033705 (30%), Rat ENSRNOG00000020293 (27%)

Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.