
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C12orf76 Antibody
상품 한눈에 보기
인간 C12orf76 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 재조합 발현 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공.
- 카탈로그번호
- HPA039713-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039713-100 Anti-C12orf76 Antibody, chromosome 12 open reading frame 76 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039713-25 Anti-C12orf76 Antibody, chromosome 12 open reading frame 76 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C12orf76 Antibody
Anti-C12orf76 Antibody
Target: chromosome 12 open reading frame 76 (C12orf76)
Type: Polyclonal Antibody against Human C12orf76
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human C12orf76.
Validated for use in multiple applications including IHC, WB, and ICC.
Alternative Gene Names
- FLJ40142
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 12 open reading frame 76 |
| Target Gene | C12orf76 |
| Antigen Sequence | AELEEQSNHAGMGPILPAMPSVDGNHFQHPAGDCHPYGILCLQAHSASVTARQVLQ |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000033705 (30%), Rat ENSRNOG00000020293 (27%) |
Antibody Information
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



