CacheBy
Atlas Antibodies Anti-BSND Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BSND Antibody

상품 한눈에 보기

Human BSND 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 정성 분석에 적합. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증 완료. 고순도 Affinity 정제 제품으로 높은 특이성과 재현성을 제공.

카탈로그번호
HPA060617-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060617-100 Anti-BSND Antibody, barttin CLCNK type accessory beta subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060617-25 Anti-BSND Antibody, barttin CLCNK type accessory beta subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BSND Antibody

Anti-BSND Antibody

Target: barttin CLCNK-type chloride channel accessory beta subunit
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human BSND.


Alternative Gene Names

BART, DFNB73

Open Datasheet


Target Information

항목 내용
Target Protein barttin CLCNK-type chloride channel accessory beta subunit
Target Gene BSND
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDL

Verified Species Reactivity

Human


Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000006543 54%
Mouse ENSMUSG00000025418 53%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 적합한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.