CacheBy
Atlas Antibodies Anti-BSND Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BSND Antibody

상품 한눈에 보기

Human BSND 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 포함한 단백질 발현 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA053836-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053836-100 Anti-BSND Antibody, barttin CLCNK-type chloride channel accessory beta subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053836-25 Anti-BSND Antibody, barttin CLCNK-type chloride channel accessory beta subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BSND Antibody

Anti-BSND Antibody

Target: barttin CLCNK-type chloride channel accessory beta subunit
Validated Application: Orthogonal validation using IHC compared to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human BSND.

Alternative Gene Names

BART, DFNB73

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein barttin CLCNK-type chloride channel accessory beta subunit
Target Gene BSND
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDL
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000006543 (54%), Mouse ENSMUSG00000025418 (53%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet: Sodium Azide MSDS


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.