
원본
Atlas Antibodies Anti-BSN Antibody
상품 한눈에 보기
Human BSN 단백질을 인식하는 Rabbit Polyclonal 항체로, presynaptic cytomatrix 단백질 연구에 적합. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원으로 정제됨. 인간에 대해 검증되었으며, Rat 및 Mouse와 높은 서열 유사성을 가짐.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA034757-100 Anti-BSN Antibody, bassoon presynaptic cytomatrix protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034757-25 Anti-BSN Antibody, bassoon presynaptic cytomatrix protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BSN Antibody
Anti-BSN Antibody
Target: Bassoon presynaptic cytomatrix protein
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against Human BSN (Bassoon presynaptic cytomatrix protein).
Alternative Gene Names
- ZNF231
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Bassoon presynaptic cytomatrix protein |
| Target Gene | BSN |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AQEHTFLATATTVSITMASSVFMAQQKQPVVYGDPYQSRLDFGQGGGSPVCLAQVKQVEQAVQTAPYRSGPRGRPREAKFARYNLPNQVAPLA |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000030714 (92%), Mouse ENSMUSG00000032589 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



