CacheBy
Atlas Antibodies Anti-BSN Antibody
원본

Atlas Antibodies Anti-BSN Antibody

상품 한눈에 보기

Human BSN 단백질을 인식하는 Rabbit Polyclonal 항체로, presynaptic cytomatrix 단백질 연구에 적합. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원으로 정제됨. 인간에 대해 검증되었으며, Rat 및 Mouse와 높은 서열 유사성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA034757-100 Anti-BSN Antibody, bassoon presynaptic cytomatrix protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034757-25 Anti-BSN Antibody, bassoon presynaptic cytomatrix protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BSN Antibody

Anti-BSN Antibody

Target: Bassoon presynaptic cytomatrix protein
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human BSN (Bassoon presynaptic cytomatrix protein).


Alternative Gene Names

  • ZNF231

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Bassoon presynaptic cytomatrix protein
Target Gene BSN
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AQEHTFLATATTVSITMASSVFMAQQKQPVVYGDPYQSRLDFGQGGGSPVCLAQVKQVEQAVQTAPYRSGPRGRPREAKFARYNLPNQVAPLA
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000030714 (92%), Mouse ENSMUSG00000032589 (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.