CacheBy
Atlas Antibodies Anti-BSPRY Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BSPRY Antibody

상품 한눈에 보기

인간 BSPRY 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB 응용에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종간 서열 유사성(마우스 82%, 랫트 81%)을 보임. 안정적 PBS/글리세롤 버퍼에 보존제 포함.

카탈로그번호
HPA042889-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042889-100 Anti-BSPRY Antibody, B-box and SPRY domain containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042889-25 Anti-BSPRY Antibody, B-box and SPRY domain containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BSPRY Antibody

Anti-BSPRY Antibody

B-box and SPRY domain containing

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human BSPRY.

Alternative Gene Names

  • FLJ20150

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein B-box and SPRY domain containing
Target Gene BSPRY
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000028392 (82%), Rat ENSRNOG00000015105 (81%)

Antigen Sequence:

NSCAYKVGVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRGPAQLGVVLDLQVQELLFYEPASGTVLCAHHVSFPGPLFPVFAVADQTISIVR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.