
Atlas Antibodies Anti-PABPC1L2A Antibody
상품 한눈에 보기
인간 PABPC1L2A 단백질을 인식하는 폴리클로날 항체입니다. Rabbit 호스트에서 생산되었으며 IgG 아이소타입을 가집니다. IHC 등 다양한 응용 분야에 적합합니다. Affinity purification으로 높은 특이성과 순도를 제공합니다. Human에 대한 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PABPC1L2A Antibody
poly(A) binding protein, cytoplasmic 1-like 2A
Recommended Applications
면역조직화학(IHC)
Product Description
Polyclonal Antibody against Human PABPC1L2A
Alternative Gene Names
RBM32A
Target Information
- Target Protein: poly(A) binding protein, cytoplasmic 1-like 2A
- Target Gene: PABPC1L2A
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000008639 | 50% |
| Mouse | ENSMUSG00000022283 | 50% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PABPC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PABPC1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PABPC1L2A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAAF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAAF1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.