CacheBy
Atlas Antibodies Anti-PABPC1L2A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PABPC1L2A Antibody

상품 한눈에 보기

인간 PABPC1L2A 단백질을 인식하는 폴리클로날 항체입니다. Rabbit 호스트에서 생산되었으며 IgG 아이소타입을 가집니다. IHC 등 다양한 응용 분야에 적합합니다. Affinity purification으로 높은 특이성과 순도를 제공합니다. Human에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041573-100 Anti-PABPC1L2A Antibody, poly(A) binding protein, cytoplasmic 1-like 2A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041573-25 Anti-PABPC1L2A Antibody, poly(A) binding protein, cytoplasmic 1-like 2A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PABPC1L2A Antibody

Anti-PABPC1L2A Antibody

poly(A) binding protein, cytoplasmic 1-like 2A

면역조직화학(IHC)

Product Description

Polyclonal Antibody against Human PABPC1L2A

Alternative Gene Names

RBM32A

Open Datasheet

Target Information

  • Target Protein: poly(A) binding protein, cytoplasmic 1-like 2A
  • Target Gene: PABPC1L2A
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    KSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000008639 50%
Mouse ENSMUSG00000022283 50%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.