
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PABPC1L2A Antibody
상품 한눈에 보기
인간 PABPC1L2A 단백질을 인식하는 폴리클로날 항체입니다. Rabbit 호스트에서 생산되었으며 IgG 아이소타입을 가집니다. IHC 등 다양한 응용 분야에 적합합니다. Affinity purification으로 높은 특이성과 순도를 제공합니다. Human에 대한 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041573-100 Anti-PABPC1L2A Antibody, poly(A) binding protein, cytoplasmic 1-like 2A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041573-25 Anti-PABPC1L2A Antibody, poly(A) binding protein, cytoplasmic 1-like 2A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PABPC1L2A Antibody
Anti-PABPC1L2A Antibody
poly(A) binding protein, cytoplasmic 1-like 2A
Recommended Applications
면역조직화학(IHC)
Product Description
Polyclonal Antibody against Human PABPC1L2A
Alternative Gene Names
RBM32A
Target Information
- Target Protein: poly(A) binding protein, cytoplasmic 1-like 2A
- Target Gene: PABPC1L2A
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000008639 | 50% |
| Mouse | ENSMUSG00000022283 | 50% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



