CacheBy
Atlas Antibodies Anti-PAAF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PAAF1 Antibody

상품 한눈에 보기

Human PAAF1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Affinity purification 방식으로 고순도 확보. Proteasomal ATPase-associated factor 1 연구용으로 권장. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039952-100 Anti-PAAF1 Antibody, proteasomal ATPase-associated factor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039952-25 Anti-PAAF1 Antibody, proteasomal ATPase-associated factor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PAAF1 Antibody

Anti-PAAF1 Antibody

Target Information

  • Target Protein: Proteasomal ATPase-associated factor 1
  • Target Gene: PAAF1
  • Alternative Gene Names: FLJ11848, Rpn14, WDR71
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human PAAF1.

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GNIYQLDVRSPRAPVQVIHRSGAPVLSLLSVRDGFIASQGDGSCFIVQQDLDYVTELTGADCDPVYKVATWEKQIYTCCRDGLVRRYQLSDL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000011470 (22%)
  • Mouse ENSMUSG00000022346 (20%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.